PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19761.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 342aa    MW: 38040.5 Da    PI: 6.6378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19761.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+ ++++G g+W++ ++  g++R++k+c++rw +yl
       KHN19761.1 14 KGPWTPEEDQKLVQHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.41.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
       KHN19761.1  67 RGKFSQEEEQTILHLHSILGNK-WSSIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.835961IPR017930Myb domain
SuperFamilySSF466894.87E-3211108IPR009057Homeodomain-like
SMARTSM007175.9E-161363IPR001005SANT/Myb domain
PfamPF002498.5E-181461IPR001005SANT/Myb domain
CDDcd001675.00E-131661No hitNo description
PROSITE profilePS5129427.76762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2765117IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.2E-1667112IPR001005SANT/Myb domain
CDDcd001671.33E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCNEN GLKKGPWTPE EDQKLVQHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSILGNKWS SIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRT DLVSTLPYLL ALANMTDLMD HHQTLDEHAM RLQAEAVQLA KLQYLHYLIQ  180
SSNSLSTTNS YDQNATTTTN MEPTAAFSLL NSISNVKEDP VMLQQDDTPG ASFSHGIASS  240
QPLHHPNVLP HPLDPQVSFS SQSCLNSEMG QGTNFAIISQ GDHTVDHDYS SWIIPSITPP  300
NSIGTSANNP GDASSSTSSY AGGPSSYWSE LLFEDPILHE LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523816.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0B2QDZ30.0A0A0B2QDZ3_GLYSO; Transcription factor MYB39
STRINGGLYMA04G11040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-111myb domain protein 93
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]